RetrogeneDB ID: retro_cjac_3397

Retrocopy location

• Organism: Marmoset (Callithrix jacchus)
• Coordinates: ACFV01177897.1:12308..12485(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: None
• Ensembl ID: ENSCJAG00000037640
• Aliases: None
• Description: None

Sequence

>retro_cjac_3397
CTCAGCCTCCCAAGTGGCTGGAACCACAGGCATGCACCACCATGCCCAGCTTTTTAAAAGAAATTCTTAGGAGAGACAGG
GTCTTGCTATGTCCCCCAGGCTGAACTCAAACTCTTAGACTCAAGTGGTCCTCCCGCCTTGGCCTCCCAAAATGCTGGGA
TTACAGACATGAGTCAC

Alignment

ORF - retro_cjac_3397 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 60.66 %
• Parental protein coverage: 72.29 %
• Number of stop codons detected: 1
• Number of frameshifts detected: 0

Retrocopy - Parental Gene Alignment:

Parental  LSLPSSWDYRHAPPCPANFCIFL-KTGFHHVGQAGAGLELLTSSDPPASVSQSVGITGMSH
          LSLPS.W..RHAPPCPA....FL..TG...V.Q..A.L.LL.SS.PPA..SQ..GIT.MSH
Retrocopy LSLPSGWNHRHAPPCPAF*KKFLGETGSCYVPQ--AELKLLDSSGPPALASQNAGITDMSH

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
SRP051959_colon	0.00 RPM	0.18 RPM
SRP051959_heart	0.00 RPM	0.25 RPM
SRP051959_kidney	0.00 RPM	0.22 RPM
SRP051959_liver	0.00 RPM	0.13 RPM
SRP051959_lung	0.00 RPM	0.24 RPM
SRP051959_lymph_node	0.00 RPM	0.30 RPM
SRP051959_skeletal_muscle	0.00 RPM	0.17 RPM
SRP051959_spleen	0.00 RPM	0.29 RPM

ChIP-Seq

Callithrix jacchus was not studied using ChIP-Seq data.

EST

No EST(s) were mapped for retro_cjac_3397 retrocopy.

TSS

Callithrix jacchus was not studied using FANTOM5 data.

Lab

retro_cjac_3397 was not experimentally validated.

Homology

Retrocopy orthology:

Retrocopy retro_cjac_3397 has 0 orthologous retrocopies within eutheria group .

---

Parental genes homology:

Parental genes homology involve 8 parental genes, and 119 retrocopies.

Species	Parental gene accession	Retrocopies number
Callithrix jacchus	ENSCJAG00000001478	30 retrocopies	retro_cjac_3344, retro_cjac_3354, retro_cjac_3367, retro_cjac_3392, retro_cjac_3411, retro_cjac_3414, retro_cjac_3422, retro_cjac_3438, retro_cjac_3490, retro_cjac_3544, retro_cjac_3564, retro_cjac_3571, retro_cjac_3577, retro_cjac_3588, retro_cjac_3597, retro_cjac_3608, retro_cjac_3613, retro_cjac_3617, retro_cjac_3623, retro_cjac_3649, retro_cjac_3654, retro_cjac_3663, retro_cjac_3668, retro_cjac_3713, retro_cjac_3719, retro_cjac_3731, retro_cjac_3764, retro_cjac_3772, retro_cjac_3787, retro_cjac_3795,
Callithrix jacchus	ENSCJAG00000004781	25 retrocopies	retro_cjac_3350, retro_cjac_3368, retro_cjac_3371, retro_cjac_3401, retro_cjac_3403, retro_cjac_3420, retro_cjac_3462, retro_cjac_3481, retro_cjac_3489, retro_cjac_3495, retro_cjac_3504, retro_cjac_3521, retro_cjac_3536, retro_cjac_3569, retro_cjac_3578, retro_cjac_3581, retro_cjac_3589, retro_cjac_3658, retro_cjac_3678, retro_cjac_3701, retro_cjac_3744, retro_cjac_3763, retro_cjac_3771, retro_cjac_3774, retro_cjac_3805,
Callithrix jacchus	ENSCJAG00000013317	22 retrocopies	retro_cjac_3373, retro_cjac_3374, retro_cjac_3404, retro_cjac_3446, retro_cjac_3488, retro_cjac_3506, retro_cjac_3532, retro_cjac_3546, retro_cjac_3550, retro_cjac_3553, retro_cjac_3607, retro_cjac_3618, retro_cjac_3620, retro_cjac_3686, retro_cjac_3693, retro_cjac_3696, retro_cjac_3704, retro_cjac_3712, retro_cjac_3720, retro_cjac_3739, retro_cjac_3782, retro_cjac_3788,
Callithrix jacchus	ENSCJAG00000034074	2 retrocopies	retro_cjac_3497, retro_cjac_3790,
Callithrix jacchus	ENSCJAG00000034457	2 retrocopies	retro_cjac_3365, retro_cjac_3726,
Callithrix jacchus	ENSCJAG00000037640	34 retrocopies	retro_cjac_3345, retro_cjac_3347, retro_cjac_3395, retro_cjac_3397 , retro_cjac_3398, retro_cjac_3410, retro_cjac_3428, retro_cjac_3436, retro_cjac_3479, retro_cjac_3496, retro_cjac_3500, retro_cjac_3501, retro_cjac_3505, retro_cjac_3523, retro_cjac_3529, retro_cjac_3537, retro_cjac_3568, retro_cjac_3587, retro_cjac_3592, retro_cjac_3600, retro_cjac_3612, retro_cjac_3638, retro_cjac_3655, retro_cjac_3660, retro_cjac_3679, retro_cjac_3698, retro_cjac_3708, retro_cjac_3724, retro_cjac_3732, retro_cjac_3746, retro_cjac_3756, retro_cjac_3776, retro_cjac_3796, retro_cjac_3802,
Callithrix jacchus	ENSCJAG00000037769	2 retrocopies	retro_cjac_3356, retro_cjac_3507,
Callithrix jacchus	ENSCJAG00000037996	2 retrocopies	retro_cjac_3627, retro_cjac_3669,