RetrogeneDB ID: | retro_cjac_3724 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01197141.1:2015..2216(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000037640 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.42 % |
Parental protein coverage: | 81.93 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | KQFSCLSLPSSWDYRHAPPCPAN-FCIF-LKTGFHHVGQAGAGLELLTSSDPPASV-SQSVGITGMSHRT |
KQFSCLSLP.S.DYRHAPPC.AN.FCIF...TGFHHVG...AGLELLTS.DP..S..S..VGITG..H.. | |
Retrocopy | KQFSCLSLPRS*DYRHAPPCLAN>FCIF>VETGFHHVGH--AGLELLTSGDPLTSA>SKNVGITGINHHV |
Parental | W |
W | |
Retrocopy | W |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .18 RPM |
SRP051959_heart | 0 .02 RPM | 0 .25 RPM |
SRP051959_kidney | 0 .00 RPM | 0 .22 RPM |
SRP051959_liver | 0 .00 RPM | 0 .13 RPM |
SRP051959_lung | 0 .00 RPM | 0 .24 RPM |
SRP051959_lymph_node | 0 .05 RPM | 0 .30 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 0 .17 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .29 RPM |