RetrogeneDB ID: | retro_cjac_3679 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | ACFV01194543.1:2044..2244(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000037640 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.43 % |
| Parental protein coverage: | 80.72 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | WHDLGSPQPPPSGFKQFSCLSLPSSWDYRHAPPCPANFC--IFLKTGFHHV-GQAGAGLELLTSSDPPAS |
| W....S.QP...G.K..S.LSLPSSWDYR....C.A.F....F..T..H.V..QAG..LELL..SD.PAS | |
| Retrocopy | WLTKASLQPESPGLKSSSHLSLPSSWDYRCMALCSASFLKKFFGETRSHYV<HQAG--LELLNLSDLPAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .18 RPM |
| SRP051959_heart | 0 .04 RPM | 0 .25 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .22 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .13 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .24 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .30 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .17 RPM |
| SRP051959_spleen | 0 .02 RPM | 0 .29 RPM |