RetrogeneDB ID: | retro_cjac_3720 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01196947.1:2279..2492(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000013317 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.97 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SFALV-TQAGVRWRNLSSPQPLPPGFGQFSCLSLLSSWDYRHTPPCPANFL-VFVLETGFHHIGQAGLEL |
SFALV...AGV.WRNLSSP.PLP.GF.QFSCLSLLSSWDYRH.P.CPANFL.VF..E.GFH...Q.GL.. | |
Retrocopy | SFALV>SRAGVQWRNLSSPKPLPLGFRQFSCLSLLSSWDYRHAPRCPANFL<VFLVEIGFHLVDQDGLNP |
Parental | LTS |
LTS | |
Retrocopy | LTS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .09 RPM | 0 .00 RPM |
SRP051959_heart | 0 .12 RPM | 0 .00 RPM |
SRP051959_kidney | 0 .13 RPM | 0 .00 RPM |
SRP051959_liver | 0 .02 RPM | 0 .00 RPM |
SRP051959_lung | 0 .08 RPM | 0 .05 RPM |
SRP051959_lymph_node | 0 .16 RPM | 0 .05 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 0 .02 RPM |
SRP051959_spleen | 0 .15 RPM | 0 .02 RPM |