RetrogeneDB ID: | retro_cpor_1204 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_56:11485642..11486083(+) | ||
Located in intron of: | ENSCPOG00000010325 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSME3 | ||
Ensembl ID: | ENSCPOG00000012552 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.39 % |
Parental protein coverage: | 57.87 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLD |
.L.SNQ.LV..IE.VKPEI.LL.EKCNTV.MWVQLLIP..EDGNNFGVSIQE.TV..L.TVES.A.SYL. | |
Retrocopy | LLRSNQHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTATSYLR |
Parental | QISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS |
..S.YY.TRAKLVSK..KYP.VEDY.RT..E.DE.EY.S.R.I....RNQY.TLHD.ILKN.EKIK.PRS | |
Retrocopy | RFSTYYNTRAKLVSKLVKYPQVEDYLRTIAEVDENEYLSVRQILVHVRNQYATLHDVILKNMEKIKTPRS |
Parental | SNAETLY |
.N...LY | |
Retrocopy | TNTDNLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .12 RPM | 48 .08 RPM |
SRP017611_kidney | 0 .52 RPM | 44 .49 RPM |
SRP017611_liver | 0 .00 RPM | 31 .60 RPM |
SRP040447_lung | 0 .23 RPM | 45 .93 RPM |
SRP040447_skeletal_muscle | 0 .08 RPM | 40 .09 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy |
retro_cpor_1204 ,
|
Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
Homo sapiens | ENSG00000131467 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017385 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |