RetrogeneDB ID: | retro_pabe_413 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:89490495..89490936(-) | ||
Located in intron of: | ENSPPYG00000000589 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSME3 | ||
Ensembl ID: | ENSPPYG00000008372 | ||
Aliases: | None | ||
Description: | Proteasome activator complex subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:Q5RFD3] |
Percent Identity: | 69.39 % |
Parental protein coverage: | 57.87 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLD |
.L.SNQ.LV..IE.VKPEI.LL.EKC.TV.M.V.LLIP..EDGNNF.VSIQE.TV..L.TVES.AAS.L. | |
Retrocopy | LLRSNQHLVELIEWVKPEIKLLREKCSTVRM*VHLLIPKVEDGNNFRVSIQEDTVDQLWTVESTAASSLC |
Parental | QISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS |
..S.YY.TRAKLVSKI.KYP.VEDYRRTV.E.DE.EY.S.R.I...LRNQY.TL.D.ILKNIEKIK.PRS | |
Retrocopy | GFSTYYNTRAKLVSKIVKYPQVEDYRRTVAEVDENEYLSVRQILLHLRNQYATLRDVILKNIEKIKIPRS |
Parental | SNAETLY |
.N...LY | |
Retrocopy | TNSDNLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 86 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 55 .45 RPM |
SRP007412_heart | 0 .09 RPM | 23 .72 RPM |
SRP007412_kidney | 0 .36 RPM | 70 .87 RPM |
SRP007412_liver | 0 .46 RPM | 39 .20 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy | |
Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
Homo sapiens | ENSG00000131467 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005684 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000008372 | 1 retrocopy |
retro_pabe_413 ,
|
Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017385 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |