RetrogeneDB ID: | retro_sscr_784 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 4:96700827..96701268(-) | ||
Located in intron of: | ENSSSCG00000006346 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSME3 | ||
Ensembl ID: | ENSSSCG00000017385 | ||
Aliases: | None | ||
Description: | Sus scrofa proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), mRNA. [Source:RefSeq mRNA;Acc:NM_214348] |
Percent Identity: | 72.79 % |
Parental protein coverage: | 57.87 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLD |
.L.SNQ.LV..IE.VKPEI.LL.EKCNTV.MWVQLLIP..EDGNNFGVSIQE.TV..L.TVES.AASYL. | |
Retrocopy | LLRSNQHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTAASYLR |
Parental | QISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS |
..S.YY.TRAKLVSKI.KYP.VEDYRRTV.E.DE.EY.S.R.I....RNQY.TLHD.ILKNIEKIK.PRS | |
Retrocopy | RFSTYYNTRAKLVSKIVKYPQVEDYRRTVAEVDENEYLSVRQILLHVRNQYATLHDVILKNIEKIKTPRS |
Parental | SNAETLY |
.N...LY | |
Retrocopy | TNTDNLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .13 RPM | 14 .73 RPM |
SRP014902_testis | 0 .00 RPM | 26 .03 RPM |
SRP018288_heart | 0 .00 RPM | 22 .71 RPM |
SRP018288_kidney | 0 .00 RPM | 37 .04 RPM |
SRP018288_liver | 0 .00 RPM | 29 .90 RPM |
SRP018288_lung | 0 .10 RPM | 42 .05 RPM |
SRP018856_adipose | 0 .28 RPM | 24 .50 RPM |
SRP035408_brain | 0 .00 RPM | 43 .51 RPM |
SRP035408_liver | 0 .00 RPM | 41 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy | |
Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
Homo sapiens | ENSG00000131467 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000002004 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017385 | 1 retrocopy |
retro_sscr_784 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |