RetrogeneDB ID: | retro_ptro_212 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:140144831..140145272(+) | ||
Located in intron of: | ENSPTRG00000001596 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSME3 | ||
Ensembl ID: | ENSPTRG00000009225 | ||
Aliases: | None | ||
Description: | Pan troglodytes proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), mRNA. [Source:RefSeq mRNA;Acc:NM_001251895] |
Percent Identity: | 64.63 % |
Parental protein coverage: | 57.87 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLD |
.L.SNQ.LV...E.VKPEI.LL.EKCNTV.M.V..LI...EDGNNF.VSIQE.TV....TVES.AAS.L. | |
Retrocopy | LLRSNQHLVELTEWVKPEIKLLREKCNTVQM*VHPLILKVEDGNNFRVSIQEDTVDQPWTVESTAASSLC |
Parental | QISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS |
..S.YY.T.AKLVSKI.KYP.VEDYR.TV.E.DE.EY.S...I...LRN.Y.TL.D.ILKNIEKIK.PRS | |
Retrocopy | GFSTYYNT*AKLVSKIVKYPQVEDYRCTVAEVDENEYLSVCQILLYLRNEYATLRDVILKNIEKIKIPRS |
Parental | SNAETLY |
.N...LY | |
Retrocopy | TNRDNLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .13 RPM | 60 .34 RPM |
SRP007412_cerebellum | 0 .11 RPM | 67 .36 RPM |
SRP007412_heart | 0 .20 RPM | 36 .52 RPM |
SRP007412_kidney | 0 .39 RPM | 70 .22 RPM |
SRP007412_liver | 0 .59 RPM | 58 .69 RPM |
SRP007412_testis | 0 .32 RPM | 93 .16 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_245 |
Pongo abelii | retro_pabe_413 |
Oryctolagus cuniculus | retro_ocun_641 |
Bos taurus | retro_btau_1249 |
Sus scrofa | retro_sscr_784 |
Equus caballus | retro_ecab_827 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy | |
Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
Homo sapiens | ENSG00000131467 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006196 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy |
retro_ptro_212 ,
|
Sus scrofa | ENSSSCG00000017385 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |