RetrogeneDB ID: | retro_dnov_1155 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_155615:6342..6585(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HRSP12 | ||
| Ensembl ID: | ENSDNOG00000025138 | ||
| Aliases: | None | ||
| Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
| Percent Identity: | 71.6 % |
| Parental protein coverage: | 69.83 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | LGLDPSSGQLVSGGVTEEAKQALTNIGEILKAASCDFTNVVKATVLLADINDFNAVNEIYKQYFKSNFPA |
| LG..P.SG.L...GV..EA..AL.NI.EILKAA.CDF.NV.K...LLADINDF.AVN.IYK.YFKSNFPA | |
| Retrocopy | LGMYPPSGEL*LRGVMGEA*LALKNISEILKAAGCDFANVIKTVILLADINDFSAVNKIYK*YFKSNFPA |
| Parental | RAAYQVAALPK |
| RAA.QVAALPK | |
| Retrocopy | RAAFQVAALPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 19 .64 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .57 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
| SRP012922_kidney | 0 .00 RPM | 214 .11 RPM |
| SRP012922_liver | 0 .00 RPM | 351 .72 RPM |
| SRP012922_lung | 0 .00 RPM | 12 .68 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 2 .77 RPM |
| SRP012922_spleen | 0 .00 RPM | 11 .10 RPM |