RetrogeneDB ID: | retro_ptro_234 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:178480489..178480729(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HRSP12 | ||
Ensembl ID: | ENSPTRG00000020457 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 80. % |
Parental protein coverage: | 58.39 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KQALKNMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEA |
K...KNM..ILKAAGCDFTN.VKTTVLLADINDF.TVNEIYKQYFKS.FPA.AAY.VAALPKG.R.EIE. | |
Retrocopy | KKLSKNMSKILKAAGCDFTNAVKTTVLLADINDFPTVNEIYKQYFKSSFPASAAYLVAALPKGGRVEIEE |
Parental | VAVQGPLTTA |
V..Q.PLTTA | |
Retrocopy | VTDQAPLTTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .44 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .13 RPM |
SRP007412_heart | 0 .00 RPM | 8 .19 RPM |
SRP007412_kidney | 0 .00 RPM | 168 .68 RPM |
SRP007412_liver | 0 .00 RPM | 95 .13 RPM |
SRP007412_testis | 0 .00 RPM | 8 .43 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_284 |
Pongo abelii | retro_pabe_387 |
Macaca mulatta | retro_mmul_558 |
Callithrix jacchus | retro_cjac_1702 |