RetrogeneDB ID: | retro_dord_80 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | GeneScaffold_2323:36162..36503(-) | ||
| Located in intron of: | ENSDORG00000010955 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDORG00000001065 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.66 % |
| Parental protein coverage: | 56.19 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | VAAEKKVVKITSEISQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGLSSDNKTMVNLDKLKER |
| .AAEKK.VKI.SE..QT....KR.E.FN.PV.LESKK.A.A.RFGISSV.TK.LSSDNK..V....LKER | |
| Retrocopy | MAAEKKMVKIRSETLQTK---KRPEQFNIPVVLESKKGA*ADRFGISSVSTKDLSSDNKPVVKMGQLKER |
| Parental | AQRFGLNVSSIS-RKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKR |
| .Q.FGL...S.......D....K..KE.FGIV.SSAGTGT.EDT..K.R | |
| Retrocopy | VQ*FGLSLLSLE<KSKDD*KLKKS-KEQFGIVSSSAGTGTIEDTKTK*R |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011769 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020662 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007853 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000011755 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001065 | 1 retrocopy |
retro_dord_80 ,
|
| Erinaceus europaeus | ENSEEUG00000015176 | 1 retrocopy | |
| Homo sapiens | ENSG00000205323 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013217 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015053 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000010902 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028949 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000885 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000078427 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017599 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000009477 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000004630 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000029747 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000030520 | 2 retrocopies |