RetrogeneDB ID: | retro_nleu_569 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397267.1:15385939..15386297(-) | ||
Located in intron of: | ENSNLEG00000003271 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SARNP | ||
Ensembl ID: | ENSNLEG00000017599 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.3 % |
Parental protein coverage: | 71.86 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EEANEEDVLGDETEEEETKP-IELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSL |
EEAN..DVLGDETEEEETKP.IE.PVKEEE.PEKTVDV.AEKKVVKITSEIPQ.ERMQKRAER..VPVSL | |
Retrocopy | EEANA-DVLGDETEEEETKP>IEIPVKEEELPEKTVDVEAEKKVVKITSEIPQAERMQKRAERVHVPVSL |
Parental | ESKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRK |
.SKK.A.A.RFG.SSV.TKGLSS.NKP..NLDKLKERAQRFGLN.SSISRK | |
Retrocopy | *SKKTAQATRFGTSSVSTKGLSSNNKPIMNLDKLKERAQRFGLNGSSISRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011769 | 2 retrocopies | |
Bos taurus | ENSBTAG00000020662 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007853 | 8 retrocopies | |
Cavia porcellus | ENSCPOG00000011755 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001065 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000015176 | 1 retrocopy | |
Homo sapiens | ENSG00000205323 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013217 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000015053 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000010902 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000028949 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000000885 | 1 retrocopy | |
Mus musculus | ENSMUSG00000078427 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017599 | 2 retrocopies |
retro_nleu_2779, retro_nleu_569 ,
|
Procavia capensis | ENSPCAG00000009477 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004630 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000029747 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000030520 | 2 retrocopies |