RetrogeneDB ID: | retro_etel_1683 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_287394:39433..39693(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CALM2 | ||
| Ensembl ID: | ENSETEG00000018667 | ||
| Aliases: | None | ||
| Description: | calmodulin 2 (phosphorylase kinase, delta) [Source:HGNC Symbol;Acc:1445] |
| Percent Identity: | 71.91 % |
| Parental protein coverage: | 59.46 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK-DTDSEEEIREAFRVFDKDGNGYISAAELR |
| SL.QNPTEAEL.DMINEVDA.G.GTIDF.EFLTMMARK.K..TDS.EEIREA...F.KDGNGY.SA.EL. | |
| Retrocopy | SLRQNPTEAELPDMINEVDAGGCGTIDFLEFLTMMARKIK<GTDS-EEIREASNMFNKDGNGYSSATELH |
| Parental | HVMTNLGEKLTDEEVDEMI |
| H.M.NL.....DEE.D.MI | |
| Retrocopy | HMMANLK*TFKDEELDDMI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015712 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008245 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000012181 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000000040 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000009377 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000018667 | 16 retrocopies | |
| Ficedula albicollis | ENSFALG00000012828 | 1 retrocopy | |
| Gadus morhua | ENSGMOG00000009342 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000005059 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000009865 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000029016 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000017466 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009222 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008824 | 6 retrocopies | |
| Petromyzon marinus | ENSPMAG00000003323 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012430 | 5 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000013173 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008433 | 1 retrocopy | |
| Taeniopygia guttata | ENSTGUG00000002581 | 1 retrocopy |