RetrogeneDB ID: | retro_ggor_1672 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:28980276..28980488(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000143977 | ||
Ensembl ID: | ENSGGOG00000022169 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.06 % |
Parental protein coverage: | 78.02 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PPEVKKFMDKKLSLKLNGGRHVQGILRGF-DPFMNLVIDECVEMATSGQQNNIGMVDNIPNKAVSPKFLK |
P...KK.MDKKLSLKLNGGRHVQG.LRGF..PFMNLVIDECVEMATS.QQNNI.M.....N.......L. | |
Retrocopy | PHKLKKIMDKKLSLKLNGGRHVQGMLRGF<YPFMNLVIDECVEMATSKQQNNIAMLVR*GNSIIMSEALE |
Parental | KV |
.V | |
Retrocopy | QV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .05 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .22 RPM |
SRP007412_heart | 0 .00 RPM | 1 .34 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .15 RPM |
SRP007412_liver | 0 .00 RPM | 1 .45 RPM |
SRP007412_testis | 0 .10 RPM | 3 .52 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2241 |
Pan troglodytes | retro_ptro_1585 |