RetrogeneDB ID: | retro_pabe_3093 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 7:126379278..126379503(+) | ||
Located in intron of: | ENSPPYG00000017995 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPG | ||
Ensembl ID: | ENSPPYG00000012324 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
Percent Identity: | 86.67 % |
Parental protein coverage: | 98.68 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
MSK.H.PELKKF.DKKLSLKLNGGRHVQGIL.GFDP.MNLVIDECVEMATSGQQ.NIGMVVI..NSII.L | |
Retrocopy | MSKVHLPELKKFIDKKLSLKLNGGRHVQGILWGFDPLMNLVIDECVEMATSGQQKNIGMVVIQRNSIITL |
Parental | EALER |
E.LER | |
Retrocopy | ETLER |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .26 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .16 RPM |
SRP007412_heart | 0 .06 RPM | 6 .86 RPM |
SRP007412_kidney | 0 .00 RPM | 11 .10 RPM |
SRP007412_liver | 0 .00 RPM | 8 .17 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3786 |
Pan troglodytes | retro_ptro_2568 |