RetrogeneDB ID: | retro_fcat_1092 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:63027298..63027516(+) | ||
| Located in intron of: | ENSFCAG00000014089 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000008118 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.38 % |
| Parental protein coverage: | 96.05 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMAT-SGQQNNIGMVVIRGNSIIM |
| MSKA.P.ELK.FMDKKLSLKLN.GRH.QGIL.GF.PF.NLVIDECV.MAT..GQQ.N..MVVI.GNS.IM | |
| Retrocopy | MSKAYPVELKTFMDKKLSLKLNCGRHFQGILQGFSPFLNLVIDECVQMAT<CGQQHNMRMVVI*GNSVIM |
| Parental | LEAL |
| LEAL | |
| Retrocopy | LEAL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 8 .45 RPM |
| SRP017611_liver | 0 .10 RPM | 3 .74 RPM |