RetrogeneDB ID: | retro_ggor_2717 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 8:44969401..44969703(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V1G1 | ||
Ensembl ID: | ENSGGOG00000004011 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 74.76 % |
Parental protein coverage: | 86.44 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MASQSQGIQQLLQ-AEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSC |
.ASQSQGIQQLLQ..EK...EKVSEA...KN.RLKQAK...QAEIE...LQREKEFKAKEA.ALGS.GSC | |
Retrocopy | VASQSQGIQQLLQ<VEKKDFEKVSEACSQKNQRLKQAKVAVQAEIE*CHLQREKEFKAKEAVALGSQGSC |
Parental | STEVEKETQEKMTILQTYFRQNRDEVLDNLLAF |
S.EVE.ETQ.KMTILQTYF..NR.E..DNLLAF | |
Retrocopy | SMEVE-ETQDKMTILQTYFQRNREEGVDNLLAF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 53 .52 RPM |
SRP007412_cerebellum | 0 .04 RPM | 34 .75 RPM |
SRP007412_heart | 0 .00 RPM | 14 .73 RPM |
SRP007412_kidney | 0 .00 RPM | 99 .85 RPM |
SRP007412_liver | 0 .00 RPM | 31 .73 RPM |
SRP007412_testis | 0 .31 RPM | 86 .20 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4049 |
Pan troglodytes | retro_ptro_2744 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
Homo sapiens | ENSG00000136888 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000004011 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016833 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000021290 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000015857 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000010985 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000011474 | 3 retrocopies |