RetrogeneDB ID: | retro_ptro_2248 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:37322241..37322529(-) | ||
| Located in intron of: | ENSPTRG00000017015 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSPTRG00000021290 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1; V-type proton ATPase subunit G 1 [Source:UniProtKB/TrEMBL;Acc:H2QXR5] |
| Percent Identity: | 64.15 % |
| Parental protein coverage: | 89.83 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS |
| MASQSQGIQ.LL......AEK.......KNRR.KQAK...Q.EIEQY.LQRE.EFKAKEAAAL.S.GSCS | |
| Retrocopy | MASQSQGIQ*LL----QVAEKGV*DLQ*KNRREKQAKAAVQGEIEQYCLQREEEFKAKEAAALRSQGSCS |
| Parental | TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDI |
| T.VE.ETQEK.TI....FRQ.R.EVL....AF.C.I | |
| Retrocopy | TKVE-ETQEKRTIWK-QFRQKRGEVL----AFFCNI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 29 .10 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 23 .99 RPM |
| SRP007412_kidney | 0 .00 RPM | 68 .75 RPM |
| SRP007412_liver | 0 .00 RPM | 40 .23 RPM |
| SRP007412_testis | 0 .11 RPM | 52 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3198 |
| Gorilla gorilla | retro_ggor_1331 |
| Macaca mulatta | retro_mmul_2018 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Homo sapiens | ENSG00000136888 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004011 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016833 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021290 | 2 retrocopies |
retro_ptro_2248 , retro_ptro_2744,
|
| Ictidomys tridecemlineatus | ENSSTOG00000015857 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010985 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011474 | 3 retrocopies |