RetrogeneDB ID: | retro_tbel_786 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | GeneScaffold_3023:581547..581784(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V1G1 | ||
Ensembl ID: | ENSTBEG00000010985 | ||
Aliases: | None | ||
Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
Percent Identity: | 74.68 % |
Parental protein coverage: | 65.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MASQSQGIQQLLQAEKRAARKVSEPRKXXXXXXXXXXXXXXAE--QYRLQR-KEFKAKEA-ALGSHGSCS |
MASQSQGIQQLLQAEKRAA.KVSE.RK..............AE..QYRLQR.KEFKAKEA.ALGSHGSCS | |
Retrocopy | MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAVALGSHGSCS |
Parental | TEVEKETQE |
TEVEKETQE | |
Retrocopy | TEVEKETQE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
Homo sapiens | ENSG00000136888 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000004011 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016833 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000021290 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000015857 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000010985 | 2 retrocopies |
retro_tbel_2147, retro_tbel_786 ,
|
Tarsius syrichta | ENSTSYG00000011474 | 3 retrocopies |