RetrogeneDB ID: | retro_dnov_1645 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_254452:2..228(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSDNOG00000008083 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
| Percent Identity: | 90.79 % |
| Parental protein coverage: | 63.56 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKA-KEAAALGSHGSC |
| MASQSQGIQQLLQAEKRAAE.VSEARKRKN.RLKQAKE.AQAE.EQY.LQREKEFKA.KEAAALGSHGSC | |
| Retrocopy | MASQSQGIQQLLQAEKRAAE*VSEARKRKNQRLKQAKEAAQAETEQYCLQREKEFKA>KEAAALGSHGSC |
| Parental | STEVEK |
| STEVE. | |
| Retrocopy | STEVEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 80 .70 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 119 .05 RPM |
| SRP012922_heart | 0 .00 RPM | 59 .86 RPM |
| SRP012922_kidney | 0 .00 RPM | 150 .31 RPM |
| SRP012922_liver | 0 .00 RPM | 54 .03 RPM |
| SRP012922_lung | 0 .00 RPM | 142 .95 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 70 .10 RPM |
| SRP012922_spleen | 0 .00 RPM | 144 .68 RPM |