RetrogeneDB ID: | retro_hvul_97 | ||
Retrocopy location | Organism: | Barley (Hordeum vulgare) | |
| Coordinates: | 7:37627163..37627403(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | MLOC_14907 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.25 % |
| Parental protein coverage: | 88.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGKRKA-AAKPPPRKRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEANCQICQESFSTTANALTEAIDI |
| MGKRK...AK..PRK...KLDT.F.CPFCNH..S..C.ID.K....EA.C..C.ES.STTA.ALTE..D. | |
| Retrocopy | MGKRKSTSAKTAPRKKAEKLDTTFCCPFCNHPGSIDCKIDLKHMVAEASCSACLESYSTTAHALTEPVDV |
| Parental | YSEWIDECER |
| Y.EWIDECE. | |
| Retrocopy | YAEWIDECEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryza sativa indica | BGIOSGA007878 | 1 retrocopy | |
| Hordeum vulgare | MLOC_14907 | 3 retrocopies |
retro_hvul_85, retro_hvul_89, retro_hvul_97 ,
|
| Oryza barthii | OBART07G23140 | 1 retrocopy | |
| Oryza glumaepatula | OGLUM07G23200 | 1 retrocopy | |
| Oryza nivara | ONIVA07G23000 | 1 retrocopy | |
| Oryza sativa japonica | OS07G0631100 | 1 retrocopy | |
| Sorghum bicolor | Sb10g003710 | 1 retrocopy | |
| Setaria italica | Si007595m.g | 2 retrocopies | |
| Triticum aestivum | Traes_1DL_84C83461E | 2 retrocopies |