RetrogeneDB ID: | retro_mdom_810 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:60932273..60932737(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS7 | ||
| Ensembl ID: | ENSMODG00000014495 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S7 [Source:HGNC Symbol;Acc:10440] |
| Percent Identity: | 54.43 % |
| Parental protein coverage: | 79.38 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | MFSSSAKIVKPNGEKPDEFESGI-SQALLELEMNSDLKAQLRELNITAA-KEIEVGGGRKAIIIFVPVPQ |
| .F.SS..I.KPNG.KPDEFE.GI.SQALLELE.NS.LKAQL....IT.A..EIEV.GGRKA......... | |
| Retrocopy | IFCSSTEIAKPNGRKPDEFEPGI<SQALLELEINSYLKAQLKAPHITVA>NEIEVVGGRKAMNDVISILN |
| Parental | -LKSFQKIQVRLVRELEKKFSGKHVVFIAQR-RILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFP |
| .LKS..KIQ..LV.EL.K..SGKHV.F...R.......TRKS.TK..QK..RS...TAV.D.I..D.VFP | |
| Retrocopy | <LKSI*KIQEWLVHELGKSSSGKHVCFLFFRGDFILSQTRKSYTKYLQKHLRSHISTAVYDPIFKDFVFP |
| Parental | SEIVGKRIRVKLDGSRLI |
| S.I.G.......D..R.I | |
| Retrocopy | SKIIGNFN*ITADS*RYI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 458 .31 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 217 .75 RPM |
| SRP007412_heart | 0 .00 RPM | 577 .52 RPM |
| SRP007412_kidney | 0 .00 RPM | 1131 .16 RPM |
| SRP007412_liver | 0 .00 RPM | 1676 .62 RPM |
| SRP007412_testis | 0 .00 RPM | 336 .49 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016462 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023243 | 2 retrocopies | |
| Homo sapiens | ENSG00000171863 | 14 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023095 | 13 retrocopies | |
| Loxodonta africana | ENSLAFG00000015087 | 11 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006121 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011870 | 7 retrocopies | |
| Monodelphis domestica | ENSMODG00000014495 | 2 retrocopies |
retro_mdom_662, retro_mdom_810 ,
|
| Mus musculus | ENSMUSG00000061477 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008507 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000028165 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005085 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025872 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000011615 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002071 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008551 | 2 retrocopies |