RetrogeneDB ID: | retro_mdom_810 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:60932273..60932737(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS7 | ||
Ensembl ID: | ENSMODG00000014495 | ||
Aliases: | None | ||
Description: | ribosomal protein S7 [Source:HGNC Symbol;Acc:10440] |
Percent Identity: | 54.43 % |
Parental protein coverage: | 79.38 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | MFSSSAKIVKPNGEKPDEFESGI-SQALLELEMNSDLKAQLRELNITAA-KEIEVGGGRKAIIIFVPVPQ |
.F.SS..I.KPNG.KPDEFE.GI.SQALLELE.NS.LKAQL....IT.A..EIEV.GGRKA......... | |
Retrocopy | IFCSSTEIAKPNGRKPDEFEPGI<SQALLELEINSYLKAQLKAPHITVA>NEIEVVGGRKAMNDVISILN |
Parental | -LKSFQKIQVRLVRELEKKFSGKHVVFIAQR-RILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFP |
.LKS..KIQ..LV.EL.K..SGKHV.F...R.......TRKS.TK..QK..RS...TAV.D.I..D.VFP | |
Retrocopy | <LKSI*KIQEWLVHELGKSSSGKHVCFLFFRGDFILSQTRKSYTKYLQKHLRSHISTAVYDPIFKDFVFP |
Parental | SEIVGKRIRVKLDGSRLI |
S.I.G.......D..R.I | |
Retrocopy | SKIIGNFN*ITADS*RYI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 458 .31 RPM |
SRP007412_cerebellum | 0 .00 RPM | 217 .75 RPM |
SRP007412_heart | 0 .00 RPM | 577 .52 RPM |
SRP007412_kidney | 0 .00 RPM | 1131 .16 RPM |
SRP007412_liver | 0 .00 RPM | 1676 .62 RPM |
SRP007412_testis | 0 .00 RPM | 336 .49 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016462 | 2 retrocopies | |
Felis catus | ENSFCAG00000023243 | 2 retrocopies | |
Homo sapiens | ENSG00000171863 | 14 retrocopies | |
Gorilla gorilla | ENSGGOG00000023095 | 13 retrocopies | |
Loxodonta africana | ENSLAFG00000015087 | 11 retrocopies | |
Myotis lucifugus | ENSMLUG00000006121 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011870 | 7 retrocopies | |
Monodelphis domestica | ENSMODG00000014495 | 2 retrocopies |
retro_mdom_662, retro_mdom_810 ,
|
Mus musculus | ENSMUSG00000061477 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008507 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000028165 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005085 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025872 | 12 retrocopies | |
Pan troglodytes | ENSPTRG00000011615 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002071 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000008551 | 2 retrocopies |