RetrogeneDB ID: | retro_ggor_294 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:133070668..133070981(+) | ||
Located in intron of: | ENSGGOG00000014209 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS7 | ||
Ensembl ID: | ENSGGOG00000023095 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.94 % |
Parental protein coverage: | 53.61 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | SQALL-ELEMNSDLKAQLRELNITAAKEIEVGGGR-KAIIIFVPVPQLKSFQKIQVR-LVRELEKKFSGK |
SQALL..LE.N.DLKAQLRELN.TAAKEIEVGG.....II.FVP..QLKS.Q.I.V..L..E.EKKF..K | |
Retrocopy | SQALL>NLEINWDLKAQLRELNRTAAKEIEVGGSH<RTIIMFVPISQLKSLQEI*VL>LACEWEKKFNEK |
Parental | HVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHD |
H..FI..RRILPKP.............R...L.AVH. | |
Retrocopy | HIIFIC*RRILPKPIXXXXXXXXXXCSRRCILIAVHN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 49 .73 RPM |
SRP007412_cerebellum | 0 .00 RPM | 84 .31 RPM |
SRP007412_heart | 0 .00 RPM | 35 .52 RPM |
SRP007412_kidney | 0 .00 RPM | 189 .03 RPM |
SRP007412_liver | 0 .00 RPM | 183 .46 RPM |
SRP007412_testis | 0 .00 RPM | 82 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000018435 | 2 retrocopies | |
Bos taurus | ENSBTAG00000016224 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000003263 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009795 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013285 | 14 retrocopies | |
Equus caballus | ENSECAG00000020253 | 2 retrocopies | |
Felis catus | ENSFCAG00000023243 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000023095 | 13 retrocopies | |
Macaca mulatta | ENSMMUG00000011870 | 7 retrocopies | |
Monodelphis domestica | ENSMODG00000014495 | 2 retrocopies | |
Mus musculus | ENSMUSG00000061477 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000015407 | 10 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008507 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000025872 | 12 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002071 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000008551 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000027353 | 5 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000024830 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000001616 | 6 retrocopies |