RetrogeneDB ID: | retro_mmul_2281 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 8:26694627..26695067(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4214 | ||
| Ensembl ID: | ENSMMUG00000012473 | ||
| Aliases: | None | ||
| Description: | proteasome activator complex subunit 2 [Source:RefSeq peptide;Acc:NP_001244558] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 61.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LPGNEKVLSL-LALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQT |
| LP..EKVL.L...LVK.EVWTLKEK.ILVIT.IQHLIPKIE.G..FGV..QEK.LER.NAVKTKVE.FQ. | |
| Retrocopy | LPWHEKVLFL<VSLVKTEVWTLKEKWILVITQIQHLIPKIENGHYFGVSLQEKMLERMNAVKTKVETFQS |
| Parental | TISKYFSERGDAVAKASKETHVMD-YRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPK |
| ..SKYFSE.GDAVAKAS.E.HVMD.Y.ALVH..DEA.YGE.....LDLRAFYAELYH...SNLEKIVNPK | |
| Retrocopy | ATSKYFSEHGDAVAKASQEIHVMDYYQALVHRQDEAPYGEIEDTALDLRAFYAELYHNFRSNLEKIVNPK |
| Parental | GEEKPSMY |
| GEEKPS.Y | |
| Retrocopy | GEEKPSVY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 8 .40 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .17 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .27 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 35 .94 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .56 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007167 | 3 retrocopies | |
| Homo sapiens | ENSG00000100911 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016025 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000012473 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000079197 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015260 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016584 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005684 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000006196 | 4 retrocopies |