RetrogeneDB ID: | retro_pabe_2486 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 4:165041523..165041927(+) | ||
Located in intron of: | ENSPPYG00000015161 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSME2 | ||
Ensembl ID: | ENSPPYG00000005684 | ||
Aliases: | None | ||
Description: | proteasome (prosome, macropain) activator subunit 2 (PA28 beta) [Source:HGNC Symbol;Acc:9569] |
Percent Identity: | 88.97 % |
Parental protein coverage: | 56.49 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIP-IP |
MAKPCGVRL.GEA.KQVE.FRQNLFQEAEEFLYRFLPQKIIYLNQLLQE.SLNVADLTSLRAPLDI..IP | |
Retrocopy | MAKPCGVRLRGEACKQVEIFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEYSLNVADLTSLRAPLDIS<IP |
Parental | DPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDG |
.PPPKDDEMETDKQE.KEVPK.GFLP.N.KVL.LLALVKP.VW.LKEKCILVITWIQHLI.KIEDG | |
Retrocopy | GPPPKDDEMETDKQEMKEVPKSGFLPKNKKVLFLLALVKPGVWSLKEKCILVITWIQHLILKIEDG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .07 RPM |
SRP007412_cerebellum | 0 .00 RPM | 21 .77 RPM |
SRP007412_heart | 0 .03 RPM | 18 .15 RPM |
SRP007412_kidney | 0 .00 RPM | 78 .89 RPM |
SRP007412_liver | 0 .03 RPM | 76 .93 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2999 |
Pan troglodytes | retro_ptro_2028 |
Macaca mulatta | retro_mmul_1919 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007167 | 3 retrocopies | |
Homo sapiens | ENSG00000100911 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000016025 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000012473 | 4 retrocopies | |
Mus musculus | ENSMUSG00000079197 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015260 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000016584 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005684 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006196 | 4 retrocopies |