RetrogeneDB ID: | retro_pabe_2486 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 4:165041523..165041927(+) | ||
| Located in intron of: | ENSPPYG00000015161 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSME2 | ||
| Ensembl ID: | ENSPPYG00000005684 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) activator subunit 2 (PA28 beta) [Source:HGNC Symbol;Acc:9569] |
| Percent Identity: | 88.97 % |
| Parental protein coverage: | 56.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIP-IP |
| MAKPCGVRL.GEA.KQVE.FRQNLFQEAEEFLYRFLPQKIIYLNQLLQE.SLNVADLTSLRAPLDI..IP | |
| Retrocopy | MAKPCGVRLRGEACKQVEIFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEYSLNVADLTSLRAPLDIS<IP |
| Parental | DPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDG |
| .PPPKDDEMETDKQE.KEVPK.GFLP.N.KVL.LLALVKP.VW.LKEKCILVITWIQHLI.KIEDG | |
| Retrocopy | GPPPKDDEMETDKQEMKEVPKSGFLPKNKKVLFLLALVKPGVWSLKEKCILVITWIQHLILKIEDG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .77 RPM |
| SRP007412_heart | 0 .03 RPM | 18 .15 RPM |
| SRP007412_kidney | 0 .00 RPM | 78 .89 RPM |
| SRP007412_liver | 0 .03 RPM | 76 .93 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2999 |
| Pan troglodytes | retro_ptro_2028 |
| Macaca mulatta | retro_mmul_1919 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007167 | 3 retrocopies | |
| Homo sapiens | ENSG00000100911 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016025 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000012473 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000079197 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015260 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016584 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005684 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006196 | 4 retrocopies |