RetrogeneDB ID: | retro_mmul_3 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 14:30131913..30132261(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000031038 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM12 | ||
| Ensembl ID: | ENSMMUG00000006804 | ||
| Aliases: | None | ||
| Description: | protein LSM12 homolog [Source:RefSeq peptide;Acc:NP_001253722] |
| Percent Identity: | 93.58 % |
| Parental protein coverage: | 55.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | FSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPP |
| .SVGSQVS...CQEQRLQGEVVAFD.QSKMLALKCPSS.GKPNHADILLINLQYVSEVEIINDRTETPPP | |
| Retrocopy | YSVGSQVSSGACQEQRLQGEVVAFDHQSKMLALKCPSSNGKPNHADILLINLQYVSEVEIINDRTETPPP |
| Parental | LASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLF |
| LA.LNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLF | |
| Retrocopy | LAALNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 29 .47 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 33 .79 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .83 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .08 RPM |
| SRP007412_kidney | 0 .00 RPM | 26 .99 RPM |
| SRP007412_liver | 0 .00 RPM | 14 .41 RPM |
| SRP007412_testis | 0 .38 RPM | 64 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014379 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000001198 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000016381 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000002419 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008374 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029083 | 1 retrocopy | |
| Homo sapiens | ENSG00000161654 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000005202 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007501 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006391 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006804 | 1 retrocopy |
retro_mmul_3 ,
|
| Mus musculus | ENSMUSG00000020922 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010489 | 2 retrocopies | |
| Oryzias latipes | ENSORLG00000011310 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013706 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020894 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012523 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000011145 | 1 retrocopy |