RetrogeneDB ID: | retro_mmus_2830 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:68001029..68001268(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps13 | ||
| Ensembl ID: | ENSMUSG00000090862 | ||
| Aliases: | Rps13, 2700063M04Rik | ||
| Description: | ribosomal protein S13 [Source:MGI Symbol;Acc:MGI:1915302] |
| Percent Identity: | 60.24 % |
| Parental protein coverage: | 54.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | PGKGLSQSALPYRRSVPTWLKLTSDDVKEQ-IYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRIL |
| PGKGLSQ..L.Y..S.PT.LK.TS...K.Q.IYK..KKGLT.S.IGVILR....V.....VTGNKIL.IL | |
| Retrocopy | PGKGLSQLVLLYCLSAPTALKMTSEKMKKQ<IYKQGKKGLTTS*IGVILRHLCSVVHGCYVTGNKILIIL |
| Parental | KSKGLAPDLPEDL |
| KS.....D.PEDL | |
| Retrocopy | KSN--VTDVPEDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 36 .17 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 19 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 43 .08 RPM |
| SRP007412_kidney | 0 .00 RPM | 34 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 31 .90 RPM |
| SRP007412_testis | 0 .00 RPM | 43 .50 RPM |