RetrogeneDB ID: | retro_mputfur_306 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896902.1:20262301..20262543(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS11 | ||
| Ensembl ID: | ENSMPUG00000002599 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S11 [Source:HGNC Symbol;Acc:10384] |
| Percent Identity: | 65.85 % |
| Parental protein coverage: | 51.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KEAIEGTYIDKKCPFTGNVSIRGR-ILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPC |
| ..A.EGT.I.KK..F.GNV.IRG..ILSGVVTK.KMQRT.VI...YL..I.KYN.F.K.HKNMSV.LS.C | |
| Retrocopy | QDATEGTSIGKKFSFSGNVFIRGG<ILSGVVTKVKMQRTTVIYKNYLF*IQKYNCFKKCHKNMSVYLSSC |
| Parental | FRDVQIGDIVTV |
| FRD...GD.VTV | |
| Retrocopy | FRDGKFGDVVTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |