RetrogeneDB ID: | retro_ptro_2252 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:40335053..40335298(-) | ||
Located in intron of: | ENSPTRG00000016993 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUMO2 | ||
Ensembl ID: | ENSPTRG00000042199 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.17 % |
Parental protein coverage: | 92.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EGVKTENNDHINLKVAG-QDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQL |
.GV.T.NNDHINLK..G.QDG..VQF.I..HTPLSKLMKAYCE.QGLSMRQIRF.FD.QPI..T....Q. | |
Retrocopy | QGVNTKNNDHINLKIVG<QDGHTVQFRIRSHTPLSKLMKAYCE*QGLSMRQIRFQFDRQPITQT----QM |
Parental | EMEDEDTIDVFQQQTGGVY |
..ED......FQ.Q.GGVY | |
Retrocopy | VDEDTSDV--FQEQIGGVY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 61 .99 RPM |
SRP007412_cerebellum | 0 .00 RPM | 44 .74 RPM |
SRP007412_heart | 0 .00 RPM | 24 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 32 .40 RPM |
SRP007412_liver | 0 .00 RPM | 24 .75 RPM |
SRP007412_testis | 0 .00 RPM | 73 .98 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009189 | 13 retrocopies | |
Cavia porcellus | ENSCPOG00000004581 | 9 retrocopies | |
Homo sapiens | ENSG00000188612 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000029777 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000042199 | 19 retrocopies |
retro_ptro_1004, retro_ptro_1183, retro_ptro_1263, retro_ptro_135, retro_ptro_143, retro_ptro_1775, retro_ptro_2051, retro_ptro_2147, retro_ptro_2212, retro_ptro_2247, retro_ptro_2252 , retro_ptro_2400, retro_ptro_2463, retro_ptro_2528, retro_ptro_2605, retro_ptro_2666, retro_ptro_2759, retro_ptro_3260, retro_ptro_65,
|
Sus scrofa | ENSSSCG00000017212 | 15 retrocopies |