RetrogeneDB ID: | retro_sscr_591 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 18:8454451..8454706(+) | ||
| Located in intron of: | ENSSSCG00000016488 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO2 | ||
| Ensembl ID: | ENSSSCG00000017212 | ||
| Aliases: | SUMO2, PSMT3, SMT3H2, Smt3A | ||
| Description: | Sus scrofa SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), mRNA. [Source:RefSeq mRNA;Acc:NM_213984] |
| Percent Identity: | 75.86 % |
| Parental protein coverage: | 91.58 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDT |
| D.KPKEGV.TEN.DH.N.KVAGQDGSVVQF...RHTP.SKLMKAYCE.Q.LSMRQ.R..FD.QPINETDT | |
| Retrocopy | DKKPKEGVETENKDHVNWKVAGQDGSVVQFT--RHTPRSKLMKAYCE*QDLSMRQMRCPFDRQPINETDT |
| Parental | PAQLEMEDEDTIDVFQQ |
| .A.LEME.EDT..VF.Q | |
| Retrocopy | AAELEMEGEDTTGVFPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 46 .46 RPM |
| SRP014902_testis | 0 .14 RPM | 114 .15 RPM |
| SRP018288_heart | 0 .03 RPM | 81 .17 RPM |
| SRP018288_kidney | 0 .00 RPM | 121 .56 RPM |
| SRP018288_liver | 0 .00 RPM | 50 .53 RPM |
| SRP018288_lung | 0 .00 RPM | 85 .33 RPM |
| SRP018856_adipose | 0 .02 RPM | 126 .23 RPM |
| SRP035408_brain | 0 .00 RPM | 115 .29 RPM |
| SRP035408_liver | 0 .06 RPM | 37 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009189 | 13 retrocopies | |
| Cavia porcellus | ENSCPOG00000004581 | 9 retrocopies | |
| Homo sapiens | ENSG00000188612 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000029777 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000042199 | 19 retrocopies |
retro_ptro_1004, retro_ptro_1183, retro_ptro_1263, retro_ptro_135, retro_ptro_143, retro_ptro_1775, retro_ptro_2051, retro_ptro_2147, retro_ptro_2212, retro_ptro_2247, retro_ptro_2252, retro_ptro_2400, retro_ptro_2463, retro_ptro_2528, retro_ptro_2605, retro_ptro_2666, retro_ptro_2759, retro_ptro_3260, retro_ptro_65,
|
| Sus scrofa | ENSSSCG00000017212 | 15 retrocopies | |
| Sus scrofa | ENSSSCG00000024026 | 2 retrocopies |