RetrogeneDB ID: | retro_sscr_591 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 18:8454451..8454706(+) | ||
Located in intron of: | ENSSSCG00000016488 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUMO2 | ||
Ensembl ID: | ENSSSCG00000017212 | ||
Aliases: | SUMO2, PSMT3, SMT3H2, Smt3A | ||
Description: | Sus scrofa SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), mRNA. [Source:RefSeq mRNA;Acc:NM_213984] |
Percent Identity: | 75.86 % |
Parental protein coverage: | 91.58 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDT |
D.KPKEGV.TEN.DH.N.KVAGQDGSVVQF...RHTP.SKLMKAYCE.Q.LSMRQ.R..FD.QPINETDT | |
Retrocopy | DKKPKEGVETENKDHVNWKVAGQDGSVVQFT--RHTPRSKLMKAYCE*QDLSMRQMRCPFDRQPINETDT |
Parental | PAQLEMEDEDTIDVFQQ |
.A.LEME.EDT..VF.Q | |
Retrocopy | AAELEMEGEDTTGVFPQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 46 .46 RPM |
SRP014902_testis | 0 .14 RPM | 114 .15 RPM |
SRP018288_heart | 0 .03 RPM | 81 .17 RPM |
SRP018288_kidney | 0 .00 RPM | 121 .56 RPM |
SRP018288_liver | 0 .00 RPM | 50 .53 RPM |
SRP018288_lung | 0 .00 RPM | 85 .33 RPM |
SRP018856_adipose | 0 .02 RPM | 126 .23 RPM |
SRP035408_brain | 0 .00 RPM | 115 .29 RPM |
SRP035408_liver | 0 .06 RPM | 37 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009189 | 13 retrocopies | |
Cavia porcellus | ENSCPOG00000004581 | 9 retrocopies | |
Homo sapiens | ENSG00000188612 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000029777 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000042199 | 19 retrocopies |
retro_ptro_1004, retro_ptro_1183, retro_ptro_1263, retro_ptro_135, retro_ptro_143, retro_ptro_1775, retro_ptro_2051, retro_ptro_2147, retro_ptro_2212, retro_ptro_2247, retro_ptro_2252, retro_ptro_2400, retro_ptro_2463, retro_ptro_2528, retro_ptro_2605, retro_ptro_2666, retro_ptro_2759, retro_ptro_3260, retro_ptro_65,
|
Sus scrofa | ENSSSCG00000017212 | 15 retrocopies | |
Sus scrofa | ENSSSCG00000024026 | 2 retrocopies |