RetrogeneDB ID: | retro_ptro_256 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:208144131..208144467(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ISCA1 | ||
Ensembl ID: | ENSPTRG00000021075 | ||
Aliases: | None | ||
Description: | Pan troglodytes iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1), mRNA. [Source:RefSeq mRNA;Acc:NM_001242612] |
Percent Identity: | 91.96 % |
Parental protein coverage: | 63.64 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIE |
LQPT.AA.TLTPSAVNKIKQLLKDKPEHVGV..GV..RGCNGLSYT.EYTKTKGDSDEEVIQDGVRVFIE | |
Retrocopy | LQPTGAAFTLTPSAVNKIKQLLKDKPEHVGVNAGV*IRGCNGLSYTVEYTKTKGDSDEEVIQDGVRVFIE |
Parental | KKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI |
KKAQLTLLGTEMDYVEDKLSSEF.FNNPNIKGTCGCGE.FNI | |
Retrocopy | KKAQLTLLGTEMDYVEDKLSSEFLFNNPNIKGTCGCGETFNI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 38 .84 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .67 RPM |
SRP007412_heart | 0 .00 RPM | 11 .86 RPM |
SRP007412_kidney | 0 .00 RPM | 15 .38 RPM |
SRP007412_liver | 0 .00 RPM | 5 .04 RPM |
SRP007412_testis | 0 .00 RPM | 8 .54 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_1734 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
Homo sapiens | ENSG00000135070 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003399 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000021075 | 7 retrocopies |
retro_ptro_1047, retro_ptro_1185, retro_ptro_1316, retro_ptro_1689, retro_ptro_2149, retro_ptro_256 , retro_ptro_2842,
|
Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |