RetrogeneDB ID: | retro_ptro_2842 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:85086760..85087072(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ISCA1 | ||
| Ensembl ID: | ENSPTRG00000021075 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1), mRNA. [Source:RefSeq mRNA;Acc:NM_001242612] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 59.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK |
| MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK | |
| Retrocopy | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK |
| Parental | GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVED |
| GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVED | |
| Retrocopy | GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 38 .84 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 15 .67 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .38 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .04 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
| Homo sapiens | ENSG00000135070 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003399 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000021075 | 7 retrocopies |
retro_ptro_1047, retro_ptro_1185, retro_ptro_1316, retro_ptro_1689, retro_ptro_2149, retro_ptro_256, retro_ptro_2842 ,
|
| Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |