RetrogeneDB ID: | retro_sscr_524 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 16:40694994..40695293(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2V2 | ||
| Ensembl ID: | ENSSSCG00000022190 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2 variant 2 [Source:HGNC Symbol;Acc:12495] |
| Percent Identity: | 53.77 % |
| Parental protein coverage: | 70.83 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 4 |
| Parental | DGTVSWGLE-DDEDMTLTRWTGMIIGPPR-TNYENRIYSLKIECGPKYPEAPPSV-RFVTKINMNGINNS |
| .G.VSWGLE...E.M.L......II...R.T.YENRIY.LK..C.PKY.EA.P.V..F.TK..MN.INNS | |
| Retrocopy | NGPVSWGLE<AEE*MMLPK*AAIIIRSQR<TTYENRIYRLKL*CVPKYSEASPLV<YFATKY-MNEINNS |
| Parental | SGMVDARSIPVLAKWQNSYSIKVVLQ-ELRRLMMSK |
| S.MV.A..I..L.K.QNS...K.VLQ.ELR.....K | |
| Retrocopy | SEMVEALNIVGLTKRQNS*KLKIVLQ<ELRYVILLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 15 .13 RPM |
| SRP014902_testis | 0 .00 RPM | 25 .32 RPM |
| SRP018288_heart | 0 .00 RPM | 25 .12 RPM |
| SRP018288_kidney | 0 .00 RPM | 44 .33 RPM |
| SRP018288_liver | 0 .00 RPM | 29 .58 RPM |
| SRP018288_lung | 0 .00 RPM | 55 .80 RPM |
| SRP018856_adipose | 0 .00 RPM | 37 .17 RPM |
| SRP035408_brain | 0 .00 RPM | 130 .28 RPM |
| SRP035408_liver | 0 .00 RPM | 27 .42 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_2739 |
| Bos taurus | retro_btau_902 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000032182 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017749 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
| Mus musculus | ENSMUSG00000022674 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000293 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022190 | 1 retrocopy |
retro_sscr_524 ,
|
| Sus scrofa | ENSSSCG00000030632 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008325 | 1 retrocopy |