RetrogeneDB ID: | retro_vpac_69 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_1480:189491..189733(+) | ||
| Located in intron of: | ENSVPAG00000010767 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCBD1 | ||
| Ensembl ID: | ENSVPAG00000004496 | ||
| Aliases: | None | ||
| Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:HGNC Symbol;Acc:8646] |
| Percent Identity: | 78.05 % |
| Parental protein coverage: | 77.88 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLD-HHPEWFNVYNKVHITLSTHECAGLSERDINL |
| G.NELEG.DAIFKQFHFKDFNRAFGFMT...LQAEK.D..HPE.FNVY.K.HI.LSTHECAGLS.R.IN. | |
| Retrocopy | G*NELEGQDAIFKQFHFKDFNRAFGFMTEMLLQAEKSD<PHPEGFNVYHKFHIILSTHECAGLSKRNINR |
| Parental | ASFIEQVAVSMT |
| ASF.EQVA.S.T | |
| Retrocopy | ASFTEQVAGSVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011866 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012703 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001235 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000001397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016074 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000007201 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000010275 | 1 retrocopy | |
| Takifugu rubripes | ENSTRUG00000017869 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005775 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004496 | 1 retrocopy |
retro_vpac_69 ,
|