RetrogeneDB ID: | retro_amel_993 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
Coordinates: | GL192805.1:1026381..1026589(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSAMEG00000008509 | ||
Aliases: | None | ||
Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
Percent Identity: | 73.24 % |
Parental protein coverage: | 80.46 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TKPADDEMLFIYSHYKQATVGDINTERPGLLDLKGKAKWDAWNQL-KGTSKEDAMKAYVNKVEELKKKYG |
.KPADDE.LFIYS.YKQATVGD..TE.PGLLDL.GKAKWDAWNQL.KG.......KAY.NK.E.L.KKYG | |
Retrocopy | SKPADDEILFIYSLYKQATVGDLKTEMPGLLDLRGKAKWDAWNQL>KGLPRK-MPKAYINKIEGL*KKYG |
Parental | I |
I | |
Retrocopy | I |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |