RetrogeneDB ID: | retro_sscr_41 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 12:49272673..49272937(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSSCG00000017808 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSSSCG00000023435 | ||
| Aliases: | None | ||
| Description: | Sus scrofa diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (DBI), mRNA. [Source:RefSeq mRNA;Acc:NM_214119] |
| Percent Identity: | 57.83 % |
| Parental protein coverage: | 95.4 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSQAEFEKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDA |
| M.Q.EFE.A....K.LK....D.E.L..YS.YKQAT.GD.N...P...D.K.KAKW.AWNG.KG.SK.DA | |
| Retrocopy | MCQVEFEMACAAIKQLKGPVSDKEKLLVYSFYKQATQGDCNIPAPSATDVKAKAKWEAWNGNKGMSKMDA |
| Parental | MKAYINKVEELKK |
| M..Y..KVEELKK | |
| Retrocopy | MRLYVAKVEELKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 10 .22 RPM |
| SRP014902_testis | 0 .00 RPM | 29 .28 RPM |
| SRP018288_heart | 0 .31 RPM | 54 .88 RPM |
| SRP018288_kidney | 0 .59 RPM | 147 .56 RPM |
| SRP018288_liver | 0 .48 RPM | 177 .50 RPM |
| SRP018288_lung | 0 .10 RPM | 41 .95 RPM |
| SRP018856_adipose | 2 .49 RPM | 552 .16 RPM |
| SRP035408_brain | 1 .24 RPM | 379 .82 RPM |
| SRP035408_liver | 1 .17 RPM | 680 .73 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_168 |
| Oryctolagus cuniculus | retro_ocun_234 |
| Bos taurus | retro_btau_154 |
| Canis familiaris | retro_cfam_134 |
| Equus caballus | retro_ecab_14 |