RetrogeneDB ID: | retro_ggor_1289 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 17:17024088..17024324(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSGGOG00000010372 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.25 % |
Parental protein coverage: | 55.24 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDA-WNELKGTSKEDAMKAY |
FEKAA....HL.TKP.D.E..F.Y...KQATV.D.NTE.P.MLD..GKAK.DA.WNELK.T.KEDA.KA. | |
Retrocopy | FEKAAKDIKHLETKPADDERMFMYSRCKQATVLDLNTEWPRMLDLKGKAKQDA<WNELKDTAKEDAVKAD |
Parental | INKVEELKKK |
I.KVEEL.KK | |
Retrocopy | IDKVEELNKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .17 RPM |
SRP007412_cerebellum | 0 .00 RPM | 82 .26 RPM |
SRP007412_heart | 0 .00 RPM | 53 .82 RPM |
SRP007412_kidney | 0 .00 RPM | 172 .35 RPM |
SRP007412_liver | 0 .00 RPM | 160 .67 RPM |
SRP007412_testis | 0 .00 RPM | 19 .68 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3345 |
Pan troglodytes | retro_ptro_2140 |
Pongo abelii | retro_pabe_2755 |