RetrogeneDB ID: | retro_ggor_1289 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 17:17024088..17024324(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSGGOG00000010372 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.25 % |
| Parental protein coverage: | 55.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | FEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDA-WNELKGTSKEDAMKAY |
| FEKAA....HL.TKP.D.E..F.Y...KQATV.D.NTE.P.MLD..GKAK.DA.WNELK.T.KEDA.KA. | |
| Retrocopy | FEKAAKDIKHLETKPADDERMFMYSRCKQATVLDLNTEWPRMLDLKGKAKQDA<WNELKDTAKEDAVKAD |
| Parental | INKVEELKKK |
| I.KVEEL.KK | |
| Retrocopy | IDKVEELNKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .17 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 82 .26 RPM |
| SRP007412_heart | 0 .00 RPM | 53 .82 RPM |
| SRP007412_kidney | 0 .00 RPM | 172 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 160 .67 RPM |
| SRP007412_testis | 0 .00 RPM | 19 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3345 |
| Pan troglodytes | retro_ptro_2140 |
| Pongo abelii | retro_pabe_2755 |