RetrogeneDB ID: | retro_cfam_1499 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 32:17395898..17396338(-) | ||
Located in intron of: | ENSCAFG00000010071 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2V1 | ||
Ensembl ID: | ENSCAFG00000032244 | ||
Aliases: | None | ||
Description: | Canis lupus familiaris ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), mRNA. [Source:RefSeq mRNA;Acc:NM_001205096] |
Percent Identity: | 84.56 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE |
.AATTGSGVKVPRNF.L..ELE.GQK.VGDGTVSWGLEDDEDMTLT..TGMI.GPPRTIYENRIY.LKIE | |
Retrocopy | IAATTGSGVKVPRNFQLFKELE-GQKVVGDGTVSWGLEDDEDMTLT**TGMITGPPRTIYENRIYNLKIE |
Parental | CGPKYPEA-PPFVRFVTKINMNGVNSSNGVVD-PRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQ |
.GPKY.EA.PPFVRFVTKIN.NG.NSSNGV.D.PRAISVLAKWQNSY.IKVVLQEL..LMMSK.NMKLP. | |
Retrocopy | FGPKYLEA>PPFVRFVTKININGINSSNGVMD>PRAISVLAKWQNSYTIKVVLQELWHLMMSKGNMKLPR |
Parental | PPEGQCYSN |
.PEGQCYSN | |
Retrocopy | RPEGQCYSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 68 .00 RPM |
SRP017611_brain | 0 .00 RPM | 58 .12 RPM |
SRP017611_kidney | 0 .00 RPM | 52 .50 RPM |
SRP017611_liver | 0 .07 RPM | 14 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000028827 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032244 | 8 retrocopies |
retro_cfam_1005, retro_cfam_1066, retro_cfam_1299, retro_cfam_1340, retro_cfam_1499 , retro_cfam_2186, retro_cfam_494, retro_cfam_604,
|
Homo sapiens | ENSG00000244687 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000012228 | 6 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000026172 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000025894 | 12 retrocopies | |
Pan troglodytes | ENSPTRG00000013615 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000025580 | 21 retrocopies |
retro_rnor_1014, retro_rnor_1032, retro_rnor_1291, retro_rnor_1609, retro_rnor_1649, retro_rnor_1650, retro_rnor_1651, retro_rnor_2055, retro_rnor_2282, retro_rnor_2406, retro_rnor_2407, retro_rnor_2412, retro_rnor_2488, retro_rnor_2489, retro_rnor_2490, retro_rnor_2534, retro_rnor_2535, retro_rnor_2905, retro_rnor_819, retro_rnor_881, retro_rnor_991,
|
Ictidomys tridecemlineatus | ENSSTOG00000014322 | 6 retrocopies |