RetrogeneDB ID: | retro_cfam_1530 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 33:12539714..12539924(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E1 | ||
Ensembl ID: | ENSCAFG00000031898 | ||
Aliases: | ATP6V0E1, ATP6H, ATP6V0E | ||
Description: | Canis lupus familiaris ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 (ATP6V0E1), mRNA. [Source:RefSeq mRNA;Acc:NM_001003128] |
Percent Identity: | 78.57 % |
Parental protein coverage: | 86.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP |
..SVFWGF.GFC.PWFIP.GP..GVII.ML.TCS..CYLF.LIA.LAQLN.LFGPQLKNETIWYLK.HWP | |
Retrocopy | MVSVFWGFTGFCMPWFIP*GPSWGVIIIMLITCSIFCYLFGLIAMLAQLNSLFGPQLKNETIWYLKCHWP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 11 .21 RPM |
SRP017611_brain | 0 .00 RPM | 8 .73 RPM |
SRP017611_kidney | 0 .00 RPM | 166 .22 RPM |
SRP017611_liver | 0 .00 RPM | 20 .74 RPM |