RetrogeneDB ID: | retro_btau_1428 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 5:57822788..57823004(-) | ||
Located in intron of: | ENSBTAG00000020662 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E1 | ||
Ensembl ID: | ENSBTAG00000015100 | ||
Aliases: | ATP6V0E1, ATP6V0E | ||
Description: | V-type proton ATPase subunit e 1 [Source:UniProtKB/Swiss-Prot;Acc:P81103] |
Percent Identity: | 86.11 % |
Parental protein coverage: | 88.89 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LIVMSVFWGIVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYH |
LIVM.VFWG.VGFLV.WFIPKGPN.GV.ITMLV.CSVCCYLFWLI.ILAQLNP.F.P.LKNETIWYLKYH | |
Retrocopy | LIVMNVFWGFVGFLVFWFIPKGPN*GVTITMLVICSVCCYLFWLIPILAQLNPFFRP*LKNETIWYLKYH |
Parental | WP |
WP | |
Retrocopy | WP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 1 .01 RPM | 52 .56 RPM |
ERP005899_muscle | 0 .42 RPM | 60 .34 RPM |
SRP017611_brain | 3 .56 RPM | 7 .86 RPM |
SRP017611_kidney | 0 .65 RPM | 72 .31 RPM |
SRP017611_liver | 0 .08 RPM | 42 .96 RPM |
SRP030211_testis | 0 .40 RPM | 68 .05 RPM |