RetrogeneDB ID: | retro_ggor_2206 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:116342249..116342478(+) | ||
Located in intron of: | ENSGGOG00000011786 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E1 | ||
Ensembl ID: | ENSGGOG00000006701 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.95 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCY-LFWLIAILAQLNPLFGPQLK |
.AYHGLT....V.S.FWGFVGF.VP.F.PK.PN.GVIITM.VTCSV.C..LFWLIAILAQ.NPL..P.LK | |
Retrocopy | IAYHGLT----VTSMFWGFVGFFVP*FVPKRPNWGVIITMMVTCSV-CH>LFWLIAILAQCNPLYRPLLK |
Parental | NETIWYLKYHWP |
.ET.WYLK.HWP | |
Retrocopy | DETTWYLKHHWP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 13 .76 RPM |
SRP007412_cerebellum | 0 .12 RPM | 14 .89 RPM |
SRP007412_heart | 0 .00 RPM | 20 .08 RPM |
SRP007412_kidney | 0 .00 RPM | 135 .34 RPM |
SRP007412_liver | 0 .03 RPM | 75 .28 RPM |
SRP007412_testis | 0 .21 RPM | 48 .59 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3240 |
Pan troglodytes | retro_ptro_2190 |
Pongo abelii | retro_pabe_2688 |
Callithrix jacchus | retro_cjac_1923 |