RetrogeneDB ID: | retro_ocun_1653 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018743:534873..535104(-) | ||
| Located in intron of: | ENSOCUG00000015800 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSOCUG00000006174 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 61.45 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCS-VCCYLFWLIAILAQLNPL-FGPQL |
| MAY....V....M....GF...LVPWFIP.GP..GVII..L.TCS....YLFWL..IL.QL.PL.FGPQ. | |
| Retrocopy | MAYRSFRVACTLM----GFDSCLVPWFIPQGPSWGVIISTLMTCS<IFGYLFWLMVILVQLSPL>FGPQ* |
| Parental | KNETIWYLKYHWP |
| .NETIWYLKYHWP | |
| Retrocopy | TNETIWYLKYHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 105 .11 RPM |
| SRP017611_liver | 0 .00 RPM | 29 .13 RPM |