RetrogeneDB ID: | retro_ggor_1937 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 3:42896770..42897010(-) | ||
Located in intron of: | ENSGGOG00000001842 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E1 | ||
Ensembl ID: | ENSGGOG00000006701 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.25 % |
Parental protein coverage: | 98.77 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNE |
AYHGL.VP..VMS.FWGFVGFLVPWFIPKGP...VIIT.LVTC.V.CYLFWLI.ILAQLNPLFGPQL.NE | |
Retrocopy | AYHGLMVPFAVMSMFWGFVGFLVPWFIPKGPYWEVIITILVTCPVFCYLFWLISILAQLNPLFGPQLTNE |
Parental | TIWYLKYHWP |
..WYLK.HWP | |
Retrocopy | AVWYLKHHWP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 13 .76 RPM |
SRP007412_cerebellum | 0 .12 RPM | 14 .89 RPM |
SRP007412_heart | 0 .06 RPM | 20 .08 RPM |
SRP007412_kidney | 0 .33 RPM | 135 .34 RPM |
SRP007412_liver | 0 .11 RPM | 75 .28 RPM |
SRP007412_testis | 0 .10 RPM | 48 .59 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2780 |
Pan troglodytes | retro_ptro_1881 |