RetrogeneDB ID: | retro_cfam_389 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 10:45641870..45642103(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSCAFG00000032714 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
Percent Identity: | 64.56 % |
Parental protein coverage: | 67.24 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQV-KQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS |
AS.....GLT.AAAGFAG..VLQAM.HVEP...K.V.Q.L.KS.FSGGY.RGGFEP..T.REAAL....S | |
Retrocopy | ASAAGEAGLTTAAAGFAGCCVLQAMGHVEPRE<KHVSQHLLKSTFSGGYSRGGFEPYITRREAALVPSTS |
Parental | PTANKGKIR |
P..NKGK.R | |
Retrocopy | PAGNKGKMR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 34 .82 RPM |
SRP017611_brain | 0 .00 RPM | 20 .48 RPM |
SRP017611_kidney | 0 .00 RPM | 72 .38 RPM |
SRP017611_liver | 0 .00 RPM | 24 .07 RPM |