RetrogeneDB ID: | retro_eeur_455 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_310150:4337..4541(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSEEUG00000006955 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
Percent Identity: | 83.82 % |
Parental protein coverage: | 58.62 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGV |
ASTVVAVGLTIA.AGFAG..VLQAMKHVEPQVKQVFQSL.KS.FSG.YYR.GFEPK.T..EA.LILGV | |
Retrocopy | ASTVVAVGLTIATAGFAGHCVLQAMKHVEPQVKQVFQSLLKSVFSGNYYRAGFEPKTTEWEAVLILGV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 11 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 29 .82 RPM |
SRP017611_liver | 0 .00 RPM | 16 .08 RPM |