RetrogeneDB ID: | retro_ptro_404 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:224716586..224716834(-) | ||
| Located in intron of: | ENSPTRG00000002185 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSPTRG00000030046 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.76 % |
| Parental protein coverage: | 71.55 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTAN |
| VVA.GLTI.A..FAG..VLQAMKHMEPQ..QVFQSLPKSAF.GGYYRGGFEPKMTK.EAALIL.V.PTA. | |
| Retrocopy | VVAAGLTIVAVEFAGH*VLQAMKHMEPQAEQVFQSLPKSAFGGGYYRGGFEPKMTKWEAALILHVCPTAS |
| Parental | K-GKIRDAHRRIML |
| K.GKI..AHR.IML | |
| Retrocopy | K<GKIIAAHRQIML |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .71 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .92 RPM |
| SRP007412_heart | 0 .00 RPM | 21 .19 RPM |
| SRP007412_kidney | 0 .00 RPM | 21 .37 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .67 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .22 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_538 |
| Gorilla gorilla | retro_ggor_491 |