RetrogeneDB ID: retro_chof_839

Retrocopy location

• Organism: Sloth (Choloepus hoffmanni)
• Coordinates: scaffold_154591:3215..3402(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: APOO
• Ensembl ID: ENSCHOG00000000226
• Aliases: None
• Description: apolipoprotein O [Source:HGNC Symbol;Acc:28727]

Sequence

>retro_chof_839
CCCAAACTAAGCCCAAGATGCAAAGTATTGTTTAACAGCTATGAATATCTCCAAACTGAACCTCCTGGATTTTTTTCCAA
TACTTGGTGTAATTGTTTTTGCTAGACTTGTTGGACTCCTTTTGGCTAGAGGTTCAAAAATGAAGAAGCTGGTATATCTG
CCTGATTTCATGGAATTAGCTAACTCT

Alignment

ORF - retro_chof_839 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 65.08 %
• Parental protein coverage: 52.1 %
• Number of stop codons detected: 0
• Number of frameshifts detected: 1

Retrocopy - Parental Gene Alignment:

Parental  PKMQSIVQQGVDSYEYLQNAPPGFF-PRLGVIGFAGLLGLLLARGSKIKKLVYPPGFMGLAAS
          PK..........SYEYLQ..PPGFF.P.LGVI.FA.L.GLLLARGSK.KKLVY.P.FM.LA.S
Retrocopy PKLSPRCKVLFNSYEYLQTEPPGFF>PILGVIVFARLVGLLLARGSKMKKLVYLPDFMELANS

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Choloepus hoffmanni was not studied using RNA-Seq expression data.

ChIP-Seq

Choloepus hoffmanni was not studied using ChIP-Seq data.

EST

Choloepus hoffmanni was not studied using EST data.

TSS

Choloepus hoffmanni was not studied using FANTOM5 data.

Lab

retro_chof_839 was not experimentally validated.

Homology

Retrocopy orthology:

Choloepus hoffmanni does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

---

Parental genes homology:

Parental genes homology involve 26 parental genes, and 77 retrocopies.

Species	Parental gene accession	Retrocopies number
Ailuropoda melanoleuca	ENSAMEG00000012749	1 retrocopy	retro_amel_1282,
Choloepus hoffmanni	ENSCHOG00000000226	2 retrocopies	retro_chof_2372, retro_chof_839 ,
Callithrix jacchus	ENSCJAG00000004909	8 retrocopies	retro_cjac_1360, retro_cjac_1417, retro_cjac_1448, retro_cjac_1767, retro_cjac_1792, retro_cjac_1896, retro_cjac_2038, retro_cjac_2063,
Cavia porcellus	ENSCPOG00000004197	1 retrocopy	retro_cpor_309,
Dasypus novemcinctus	ENSDNOG00000006710	1 retrocopy	retro_dnov_2450,
Equus caballus	ENSECAG00000013441	1 retrocopy	retro_ecab_145,
Echinops telfairi	ENSETEG00000014150	3 retrocopies	retro_etel_1052, retro_etel_516, retro_etel_711,
Felis catus	ENSFCAG00000000029	3 retrocopies	retro_fcat_1203, retro_fcat_1657, retro_fcat_1798,
Homo sapiens	ENSG00000184831	5 retrocopies	retro_hsap_1018, retro_hsap_1693, retro_hsap_2670, retro_hsap_3047, retro_hsap_3259,
Gorilla gorilla	ENSGGOG00000001200	4 retrocopies	retro_ggor_1269, retro_ggor_1863, retro_ggor_2098, retro_ggor_806,
Loxodonta africana	ENSLAFG00000029070	1 retrocopy	retro_lafr_1114,
Macropus eugenii	ENSMEUG00000014222	1 retrocopy	retro_meug_700,
Macaca mulatta	ENSMMUG00000016361	4 retrocopies	retro_mmul_1584, retro_mmul_1886, retro_mmul_2051, retro_mmul_814,
Monodelphis domestica	ENSMODG00000025554	1 retrocopy	retro_mdom_1510,
Mustela putorius furo	ENSMPUG00000000109	1 retrocopy	retro_mputfur_109,
Mus musculus	ENSMUSG00000079508	1 retrocopy	retro_mmus_282,
Nomascus leucogenys	ENSNLEG00000010026	5 retrocopies	retro_nleu_1167, retro_nleu_1338, retro_nleu_1944, retro_nleu_456, retro_nleu_898,
Otolemur garnettii	ENSOGAG00000001960	6 retrocopies	retro_ogar_1083, retro_ogar_1104, retro_ogar_2092, retro_ogar_2466, retro_ogar_2927, retro_ogar_3094,
Pongo abelii	ENSPPYG00000020191	7 retrocopies	retro_pabe_1394, retro_pabe_1417, retro_pabe_2215, retro_pabe_2417, retro_pabe_2434, retro_pabe_2702, retro_pabe_856,
Pan troglodytes	ENSPTRG00000021742	5 retrocopies	retro_ptro_1147, retro_ptro_1799, retro_ptro_1992, retro_ptro_2205, retro_ptro_746,
Pteropus vampyrus	ENSPVAG00000002530	2 retrocopies	retro_pvam_128, retro_pvam_594,
Rattus norvegicus	ENSRNOG00000046918	4 retrocopies	retro_rnor_1022, retro_rnor_1986, retro_rnor_2096, retro_rnor_2308,
Sarcophilus harrisii	ENSSHAG00000008734	1 retrocopy	retro_shar_125,
Sus scrofa	ENSSSCG00000012174	1 retrocopy	retro_sscr_774,
Tupaia belangeri	ENSTBEG00000014888	6 retrocopies	retro_tbel_1153, retro_tbel_4004, retro_tbel_4261, retro_tbel_4698, retro_tbel_715, retro_tbel_96,
Tarsius syrichta	ENSTSYG00000010239	2 retrocopies	retro_tsyr_1089, retro_tsyr_2155,