RetrogeneDB ID: | retro_cpor_1331 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_7:16445592..16445934(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C11ORF58 | ||
| Ensembl ID: | ENSCPOG00000009679 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.91 % |
| Parental protein coverage: | 62.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSAARESHPHGVKRSASPDDDLGSSNWEAADLGSEERK-QKFLRLMGAGKKEHTGRLVIGDHKSTSHFRT |
| MS..RESHP..VK.SAS.....GSSNWEAA...SE....Q..LR..GAGKK.H.G.LVIGDHKSTSHF.. | |
| Retrocopy | MSKVRESHPCRVKHSASCGEEPGSSNWEAANICSEXXXXQRSLRFKGAGKKGHSGCLVIGDHKSTSHFIV |
| Parental | GEEDKKINEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGE |
| .E..K...E.LESQYQQ.MDSKL.GRYR.H.GL.FSE.E.HDGE | |
| Retrocopy | DEKQKENIEPLESQYQQRMDSKLTGRYRPHSGLDFSESEGHDGE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 28 .30 RPM |
| SRP017611_kidney | 0 .00 RPM | 34 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 30 .21 RPM |
| SRP040447_lung | 0 .00 RPM | 34 .93 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 30 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030220 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009626 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009679 | 2 retrocopies |
retro_cpor_1331 , retro_cpor_772,
|
| Equus caballus | ENSECAG00000011778 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027747 | 1 retrocopy | |
| Homo sapiens | ENSG00000110696 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000011795 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001589 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007147 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000030663 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017719 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025335 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000000154 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003458 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020436 | 1 retrocopy |