RetrogeneDB ID: | retro_cpor_584 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:41836738..41836936(+) | ||
| Located in intron of: | ENSCPOG00000004935 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS21 | ||
| Ensembl ID: | ENSCPOG00000001965 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S21 [Source:UniProtKB/TrEMBL;Acc:H0UXF6] |
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 79.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | SASNRIIGAKDHAS-IQMNVAEVDKVTGRFNGQFKTYAICGAIRRMG-ESDDSILRLAKADGIVSKNF |
| SAS..I.GAKD.AS..QM.VAE.DK.TGRF.G.FKTYA.C..IRRMG.ESDD.IL.LAKA.G.V.KNF | |
| Retrocopy | SASSCISGAKDQAS<LQMKVAEADKITGRFSGRFKTYAVCETIRRMG>ESDDYILQLAKAYGVV*KNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 57 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 62 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 50 .01 RPM |
| SRP040447_lung | 0 .00 RPM | 157 .00 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 154 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017399 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020795 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000012676 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014195 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000001965 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023745 | 7 retrocopies | |
| Latimeria chalumnae | ENSLACG00000012753 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016769 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000003361 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000011205 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000013708 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000006325 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000021825 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001029 | 5 retrocopies |