RetrogeneDB ID: | retro_btau_1780 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | X:125195355..125195582(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS21 | ||
Ensembl ID: | ENSBTAG00000020795 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S21 [Source:UniProtKB/Swiss-Prot;Acc:Q32PB8] |
Percent Identity: | 70.13 % |
Parental protein coverage: | 91.57 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDD-SILRLAKAD |
F.DLY.P.K.S..N.II..K.HA.IQMNVA.VDKVT.RFNGQFKTY.I..AI.RMGES.D.SIL.LAKA. | |
Retrocopy | FMDLYMPQKFSSGNPIISTKNHAPIQMNVAKVDKVTVRFNGQFKTYSIYWAIHRMGESED<SILQLAKAK |
Parental | GIVSKNF |
.I.SKNF | |
Retrocopy | AIISKNF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 35 .90 RPM |
ERP005899_muscle | 0 .00 RPM | 339 .38 RPM |
SRP017611_brain | 0 .00 RPM | 22 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 65 .50 RPM |
SRP017611_liver | 0 .00 RPM | 35 .64 RPM |
SRP030211_testis | 0 .00 RPM | 60 .34 RPM |